PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0033s0490.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 576aa    MW: 64176 Da    PI: 5.549
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0033s0490.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.41.3e-962205734373
                    GRAS   4 lLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                              + ++Ae +++g+  laq +Larl+++ + p g+p qR+a+yf+eAL+  l+       +  ++      n + ++ a+k fse+sP
  SapurV1A.0033s0490.3.p 220 PICQAAELIETGNPVLAQGILARLNHQlSVPIGKPYQRAAFYFKEALQLLLNM------NNNNSIGI-ACNLIFKIGAYKSFSEISP 299
                             5789*********************9989999******************998......22222222.35699************** PP

                    GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                             il+f ++t+Nqa+lea+eg er+H++Dfdi++G+QW++L+q+La R++g+psl+iT+++sp+s+++ el  t+e+L+ fA+e+++pf
  SapurV1A.0033s0490.3.p 300 ILQFENFTCNQALLEAFEGFERIHVVDFDIGYGGQWASLMQELALRNGGAPSLKITAFASPSSQDELELGFTQENLKIFASEVNMPF 386
                             *************************************************************************************** PP

                    GRAS 177 efnvlvakrledl.eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                             e ++l  ++l++   + +Lrv ++E++aVnl +  ++ +      +s+ + vL++vk+lsPkvvv  ++ + +++ +F++++ +a++
  SapurV1A.0033s0490.3.p 387 ELEILSLESLSSGsWPMHLRVTEKEVIAVNLPVGSFSNY------PSTLPLVLRFVKQLSPKVVVSLDRGCYRSDLPFAHHVNHAIQ 467
                             ****97777776625788***************888877......445567************************************ PP

                    GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                              y++l++sl+a    + ++ +k+Er+l+++ i++ v  ++ +        + Wr+ + ++GF+p+++s+++++qa++l+++++++g+
  SapurV1A.0033s0490.3.p 468 SYTSLLESLDAV-NVNLDALQKIERFLVRPGIEKSVLGRHCS----LYMTAPWRSLFLQSGFTPLTFSNFTESQAEYLVQRTPVRGF 549
                             *********665.3566999*****************99998....77789************************************ PP

                    GRAS 350 rveeesgslvlgWkdrpLvsvSaW 373
                             +ve+++ slvl+W+++ Lvs+SaW
  SapurV1A.0033s0490.3.p 550 HVEKRQSSLVLCWQQKDLVSASAW 573
                             ************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.834191554IPR005202Transcription factor GRAS
PfamPF035144.4E-94220573IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MEDWESGLDG SPSQEQSILR LIMGDVEDPF LGLNKLLQSG SRSQDMELSA SGFGVVDQVF  60
GFEVPNMSTA SASLLVNHNS TDPSSIHGIN ILPGLFQQHQ QHVAFDQDEK PRILNPGAII  120
NQNQHQFVQN PAMLYAQLEE HHNNLHFLSP PPLKRLDTGP AGANHVPKVF DLRLPESFPP  180
RQQQQFQLMQ QQRQGMIAKQ EVAGDELETQ QQLQQAIINP ICQAAELIET GNPVLAQGIL  240
ARLNHQLSVP IGKPYQRAAF YFKEALQLLL NMNNNNSIGI ACNLIFKIGA YKSFSEISPI  300
LQFENFTCNQ ALLEAFEGFE RIHVVDFDIG YGGQWASLMQ ELALRNGGAP SLKITAFASP  360
SSQDELELGF TQENLKIFAS EVNMPFELEI LSLESLSSGS WPMHLRVTEK EVIAVNLPVG  420
SFSNYPSTLP LVLRFVKQLS PKVVVSLDRG CYRSDLPFAH HVNHAIQSYT SLLESLDAVN  480
VNLDALQKIE RFLVRPGIEK SVLGRHCSLY MTAPWRSLFL QSGFTPLTFS NFTESQAEYL  540
VQRTPVRGFH VEKRQSSLVL CWQQKDLVSA SAWGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3023257318374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2118040.0AC211804.1 Populus trichocarpa clone POP017-B20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301269.10.0hypothetical protein POPTR_0002s14550g
TrEMBLB9GPD00.0B9GPD0_POPTR; Uncharacterized protein
STRINGPOPTR_0002s14550.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-159GRAS family protein